PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001382
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 250aa    MW: 28400.4 Da    PI: 8.9495
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001382genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32173231159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  DCAR_001382 173 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHT 231
                  59*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-33158231IPR003657WRKY domain
SuperFamilySSF1182902.22E-28166231IPR003657WRKY domain
PROSITE profilePS5081129.287168233IPR003657WRKY domain
SMARTSM007741.8E-36173232IPR003657WRKY domain
PfamPF031065.0E-25174230IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MLNQGGLYED RHSHLEMGSS NIGLMYDPPS FTTNSLSQIP FGCNNNIQSP RSNHSNFTTT  60
TVPSSSSLAP PPSDSPKQDH FDMNTTNHLL SLQRSSHINL WAWGEENDCI ISSSNGKRSR  120
TNINGGEIDN HSHHNNNSTL GISAIKMKKI KAARRKVREP RFCFKTLSDV DVLDDGYKWR  180
KYGQKVVKNT QHPRSYYRCT QDNCRVKKRV ERLAEDPRMV ITTYEGRHVH TPSQDEDDSS  240
SSQLNNFFW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-25165230974Probable WRKY transcription factor 4
2lex_A3e-25165230974Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016452899.16e-83PREDICTED: probable WRKY transcription factor 28
TrEMBLA0A068UYZ86e-83A0A068UYZ8_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000507452e-77(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA103762126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.13e-49WRKY DNA-binding protein 13